PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna23202.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 1824aa    MW: 198916 Da    PI: 6.7252
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna23202.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding315.8e-10921963347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE e +++  + +G++ +k+Ia+ +  ++t  +c+++++k+
  mrna23202.1-v1.0-hybrid 921 PWTPEEKEAFIEKLAVFGKD-FKKIASFFD-HKTTADCVEFYYKH 963
                              8*****************99.*********.************97 PP

2Myb_DNA-binding33.41.1e-1011361176345
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                                WT eE   +++av  +G++ ++ I+r++  +R+ +qck ++ 
  mrna23202.1-v1.0-hybrid 1136 DWTDEEKSSFIQAVSSHGKD-FAMISRCVR-TRSQNQCKVFFS 1176
                               5*****************99.*********.********8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.94E-14905966IPR009057Homeodomain-like
PROSITE profilePS5129316.148917968IPR017884SANT domain
SMARTSM007172.8E-10918966IPR001005SANT/Myb domain
PfamPF002492.0E-7920963IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-7921965IPR009057Homeodomain-like
PROSITE profilePS5129310.62111321183IPR017884SANT domain
SMARTSM007174.0E-811331181IPR001005SANT/Myb domain
SuperFamilySSF466893.28E-1011341183IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-711361177IPR009057Homeodomain-like
PfamPF002492.7E-811361176IPR001005SANT/Myb domain
CDDcd001671.20E-611371175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1824 aa     Download sequence    Send to blast
MREKRRKNSM LVLQELEEGK LRRCLLIPGG FDKLSLACFI TIDILLCSYT YNGDYSLKRK  60
VNKKKKKNLP HASHQARPGS ASVTLDGGAH GGDGKGEITR RRLWGIWKEA AVAVAVVVVV  120
WDLEPLSWDR KDFFKERKPE RSESLGPVAR WRDAPHHAPR DFNRWSSATE FRRPQPGHAK  180
QGSWHLFSDD SGHGYVPSRS SEKMLDDEGF RPSFSRGEGR YGRNGRDNRG LYNQRDCKGH  240
AWEASSLSPH TPGRPNDMNN EQRPQDDTMT YSSNPHSDFG STWDQIQLKD HLDRMGGSNG  300
LGAGQKCDRD NSLGSMDWRP LKWSRSGSMS SRGSGFSHSS SSKSIGAIDS NEAKGESQPK  360
NVTPLQSPSG DATACVTSAA PSEETTSRKK PRLGWGEGLA KYEKKKVDPA DVVMNKDGDV  420
CHVGNVEHVQ SVSPHLADKS PRLMVLTDCA SPATPSSVAC SSSPGVEEKS FGKAAGVDND  480
INLYRSPGPE FQSHQEGFSF KLEKLDYNSL ANVSSSLHEL LQSDDPSPMD CSTVRPTAMN  540
KLLIWKGDIS KVLEVTESEI DLLENELKML NSDSRDTCQC PAASSSLPVE GSDTSGKEQA  600
TAINLVTRPA PLIVCSSGDT DLEKLALGNG EQGESCGLKD QDMDSPGTAT SKFVDRLPLL  660
NVASSDIGNS SGCAENQDLV QTVEREAECL TSGKDEEKSD PSVCENSGRE IVTPVSNGLG  720
ICAGVVDTVC DSIFSSNKET ASRASDIFNK LLPKDNCKVD ISGLGISSSW KNDSLLKEKF  780
KARKRHLRFM DRVITLKYKA HQQLWKEDVR LLSERKYRPK SHKKYDLGLR NPSNGYQKHR  840
SSIRSRFSTP AGNLSLVPTK EVEKFANKVL CDSQVKLYRN SLKMPALILD KKEKVVTRFV  900
SSNGLIEDPC AVEKERTLIN PWTPEEKEAF IEKLAVFGKD FKKIASFFDH KTTADCVEFY  960
YKHHKSAAFQ KIKKKPDTSK LGKSAANTYM INPGTKWNRE VNAASLDILG AASVMAAQAD  1020
GSTRNRTGRL ILGGYKNMKI SQGDDATVER SCSFDVIGDE RETAAADVLA GICGSLSSEA  1080
VSSCITSSID PGDGCREWKC QKVDSQARRP LTPDVLQSVD DETCSDDSCG EMDPTDWTDE  1140
EKSSFIQAVS SHGKDFAMIS RCVRTRSQNQ CKVFFSKARK CLGLDLVHPR RGNEGASIVD  1200
DANGGESDTE DACVVEAGSG ISSDKSGCDM NEDLPLSVMD MDHEKTMNLQ CEPLGSVENN  1260
VKGEVDLLDK KALRSSDTLE MEDRPKLVFD DLTNIMDVAD RLSESVPAQR SEAFSADVDA  1320
VIDNVAEKGS LVAESVVGEG MSSDVPKLEG QDERCNTDTS GCGLQVSVHD SNSSGSASDM  1380
AAEGSCSGLA AECLQQVSVE FNSMQVNSLL HENLLATAEN SAVVEYGKAI NQDRLSSTSA  1440
KQEDRDKQSS IRGDDVHKHL PGLPVLRNVD PAHVLKGYPL HMAMGKEING HTSCGNLSEV  1500
KHLSKPDGDL TGHKPKDCIL QFGNCKPRSS QVDFPLVHQK TERRSDTTKA HSWSSSDTDK  1560
PSRNGDVKLF GKILTSTSKS GSSIHENEEK GSHTHNLSNK ASNLKFSGHH NLDGNSGVLK  1620
FDSSNYAGIE NVPRRNYSFW EGNKVQNGHP SFPDSALLLA KYPAAFGNFP TSSSKLEQQP  1680
LAVVRNDGHV NGASVFPSRE ISSSSSSGSG IVDYHQVFSR HRDGGAKVPP FTVDVKQRQD  1740
TFDVSRRNGF ESVSSLQQQG RGIVGMNGVN VVGRGGIMVG GPCTGVSDPV AAIRMHYAKT  1800
EQYGAQGIIR EEESWRGKGD IGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-14884970994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-14884970994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307402.10.0PREDICTED: uncharacterized protein LOC101302495
TrEMBLM5XR660.0M5XR66_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein